Class a: All alpha proteins [46456] (284 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.2: Phage repressors [47419] (7 proteins) consists of different sequence families of HTH repressors of phage origins |
Protein P22 C2 repressor, DNA-binding domain [47426] (1 species) |
Species Salmonella bacteriophage P22 [TaxId:10754] [47427] (5 PDB entries) contains a short additional helix at C-terminus |
Domain d1adra_: 1adr A: [17042] |
PDB Entry: 1adr (more details)
SCOPe Domain Sequences for d1adra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1adra_ a.35.1.2 (A:) P22 C2 repressor, DNA-binding domain {Salmonella bacteriophage P22 [TaxId: 10754]} mntqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcs pdyllkgdlsqtnvay
Timeline for d1adra_: