Lineage for d1adr__ (1adr -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2993Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
  4. 2994Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 3006Family a.35.1.2: Phage repressors [47419] (6 proteins)
  6. 3057Protein p22 C2 repressor, DNA-binding domain [47426] (1 species)
  7. 3058Species Salmonella bacteriophage p22 [TaxId:10754] [47427] (1 PDB entry)
  8. 3059Domain d1adr__: 1adr - [17042]

Details for d1adr__

PDB Entry: 1adr (more details)

PDB Description: determination of the nuclear magnetic resonance structure of the dna- binding domain of the p22 c2 repressor (1-76) in solution and comparison with the dna-binding domain of the 434 repressor

SCOP Domain Sequences for d1adr__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adr__ a.35.1.2 (-) p22 C2 repressor, DNA-binding domain {Salmonella bacteriophage p22}
mntqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcs
pdyllkgdlsqtnvay

SCOP Domain Coordinates for d1adr__:

Click to download the PDB-style file with coordinates for d1adr__.
(The format of our PDB-style files is described here.)

Timeline for d1adr__: