Lineage for d1a6xa_ (1a6x A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2082731Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2082732Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 2082733Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)
  6. 2082739Protein Biotinyl domain of acetyl-CoA carboxylase [51232] (1 species)
  7. 2082740Species Escherichia coli [TaxId:562] [51233] (4 PDB entries)
  8. 2082742Domain d1a6xa_: 1a6x A: [28215]

Details for d1a6xa_

PDB Entry: 1a6x (more details)

PDB Description: structure of the apo-biotin carboxyl carrier protein (apo-bccp87) of escherichia coli acetyl-coa carboxylase, nmr, 49 structures
PDB Compounds: (A:) apo-biotin carboxyl carrier protein of acetyl-coa carboxylase

SCOPe Domain Sequences for d1a6xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6xa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]}
meapaaaeisghivrspmvgtfyrtpspdakafievgqkvnvgdtlciveamkmmnqiea
dksgtvkailvesgqpvefdeplvvie

SCOPe Domain Coordinates for d1a6xa_:

Click to download the PDB-style file with coordinates for d1a6xa_.
(The format of our PDB-style files is described here.)

Timeline for d1a6xa_: