SCOP 1.55: Domain d1a6x__: 1a6x -

Lineage for d1a6x__ (1a6x -)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies)

4. Superfamily b.84.1: Single hybrid motif [51230] (1 family)

5. Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (5 proteins)

6. Protein Biotinyl domain of acetyl-CoA carboxylase [51232] (1 species)

7. Species Escherichia coli [TaxId:562] [51233] (4 PDB entries)

8. Domain d1a6x__: 1a6x - [28215]

Details for d1a6x__

PDB Entry: 1a6x

PDB Description: structure of the apo-biotin carboxyl carrier protein (apo-bccp87) of escherichia coli acetyl-coa carboxylase, nmr, 49 structures

SCOP Domain Sequences for d1a6x__:

Sequence; same for both SEQRES and ATOM records:

>d1a6x__ b.84.1.1 (-) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli}
meapaaaeisghivrspmvgtfyrtpspdakafievgqkvnvgdtlciveamkmmnqiea
dksgtvkailvesgqpvefdeplvvie

Timeline for d1a6x__:

• d1a6x__ appears in SCOP 1.57
  
• d1a6x__ appears in the current release, SCOPe 2.08, called d1a6xa_