SCOPe 2.08: Domain d1a6xa_: 1a6x A:

Lineage for d1a6xa_ (1a6x A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)

6. Protein Biotinyl domain of acetyl-CoA carboxylase [51232] (1 species)

7. Species Escherichia coli [TaxId:562] [51233] (4 PDB entries)

8. Domain d1a6xa_: 1a6x A: [28215]

Details for d1a6xa_

PDB Entry: 1a6x

PDB Description: structure of the apo-biotin carboxyl carrier protein (apo-bccp87) of escherichia coli acetyl-coa carboxylase, nmr, 49 structures

PDB Compounds: (A:) apo-biotin carboxyl carrier protein of acetyl-coa carboxylase

SCOPe Domain Sequences for d1a6xa_:

Sequence; same for both SEQRES and ATOM records:

>d1a6xa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]}
meapaaaeisghivrspmvgtfyrtpspdakafievgqkvnvgdtlciveamkmmnqiea
dksgtvkailvesgqpvefdeplvvie

Timeline for d1a6xa_:

• d1a6xa_ first appeared (with stable ids) in SCOP 1.55, called d1a6x__
  
• d1a6xa_ appears in SCOPe 2.07