Lineage for d1a4fb_ (1a4f B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687018Species Bar-headed goose (Anser indicus) [TaxId:8846] [46509] (4 PDB entries)
  8. 2687019Domain d1a4fb_: 1a4f B: [15573]
    Other proteins in same PDB: d1a4fa_
    complexed with hem, oxy

Details for d1a4fb_

PDB Entry: 1a4f (more details), 2 Å

PDB Description: bar-headed goose hemoglobin (oxy form)
PDB Compounds: (B:) hemoglobin (beta chain)

SCOPe Domain Sequences for d1a4fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4fb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Bar-headed goose (Anser indicus) [TaxId: 8846]}
vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv
rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak
eftpdcqaawqklvrvvahalarkyh

SCOPe Domain Coordinates for d1a4fb_:

Click to download the PDB-style file with coordinates for d1a4fb_.
(The format of our PDB-style files is described here.)

Timeline for d1a4fb_: