Lineage for d1a4fb_ (1a4f B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 287Protein Hemoglobin, beta-chain [46500] (15 species)
  7. 292Species Bar-headed goose (Anser indicus) [TaxId:8846] [46509] (3 PDB entries)
  8. 293Domain d1a4fb_: 1a4f B: [15573]
    Other proteins in same PDB: d1a4fa_

Details for d1a4fb_

PDB Entry: 1a4f (more details), 2 Å

PDB Description: bar-headed goose hemoglobin (oxy form)

SCOP Domain Sequences for d1a4fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4fb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Bar-headed goose (Anser indicus)}
vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv
rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak
eftpdcqaawqklvrvvahalarkyh

SCOP Domain Coordinates for d1a4fb_:

Click to download the PDB-style file with coordinates for d1a4fb_.
(The format of our PDB-style files is described here.)

Timeline for d1a4fb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a4fa_