Lineage for d1a4fb_ (1a4f B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (16 proteins) 
Protein Hemoglobin, beta-chain [46500] (15 species) 
Species Bar-headed goose (Anser indicus) [TaxId:8846] [46509] (3 PDB entries) 
Domain d1a4fb_: 1a4f B: [15573]
Other proteins in same PDB: d1a4fa_
Details for d1a4fb_
PDB Entry: 1a4f (more details), 2 Å
PDB Description: bar-headed goose hemoglobin (oxy form)
SCOP Domain Sequences for d1a4fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a4fb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Bar-headed goose (Anser indicus)}
vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv
rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak
eftpdcqaawqklvrvvahalarkyh
SCOP Domain Coordinates for d1a4fb_:
Click to download the PDB-style file with coordinates for d1a4fb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a4fb_:
- d1a4fb_ appears in SCOP 1.57
- d1a4fb_ appears in the current release, SCOPe 2.07
View in 3D
