PDB entry 1a4f

View 1a4f on RCSB PDB site
Description: bar-headed goose hemoglobin (oxy form)
Class: oxygen transport
Keywords: oxygen transport, heme, respiratory protein, erythrocyte
Deposited on 1998-01-29, released 1998-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin (alpha chain)
    Species: Anser indicus [TaxId:8846]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a4fa_
  • Chain 'B':
    Compound: hemoglobin (beta chain)
    Species: Anser indicus [TaxId:8846]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a4fb_
  • Heterogens: HEM, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4fA (A:)
    vlsaadktnvkgvfskisghaeeygaetlermftaypqtktyfphfdlqhgsaqikahgk
    kvvaalveavnhiddiagalsklsdlhaqklrvdpvnfkflghcflvvvaihhpsaltae
    vhasldkflcavgtvltakyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4fB (B:)
    vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv
    rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak
    eftpdcqaawqklvrvvahalarkyh