Lineage for d2h3la1 (2h3l A:1310-1412)
- Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds) 
Fold b.36: PDZ domain-like [50155] (1 superfamily)
contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helixSuperfamily b.36.1: PDZ domain-like [50156] (6 families) 
peptide-binding domainFamily b.36.1.1: PDZ domain [50157] (46 proteins)
Pfam PF00595
Protein Erbin [82085] (1 species) Species Human (Homo sapiens) [TaxId:9606] [82086] (4 PDB entries) 
Domain d2h3la1: 2h3l A:1310-1412 [136046]
automatically matched to d1n7ta_
Details for d2h3la1
PDB Entry: 2h3l (more details), 1 Å
PDB Description: crystal structure of erbin pdz
PDB Compounds: (A:) LAP2 proteinSCOP Domain Sequences for d2h3la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]}
gshmghelakqeirvrvekdpelgfsisggvggrgnpfrpdddgifvtrvqpegpaskll
qpgdkiiqangysfiniehgqavsllktfqntveliivrevss
SCOP Domain Coordinates for d2h3la1:
Click to download the PDB-style file with coordinates for d2h3la1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2h3la1:
- d2h3la1 first appeared in SCOP 1.73
- d2h3la1 is called d2h3la_ in SCOPe 2.01
- d2h3la1 appears in the current release, SCOPe 2.08, called d2h3la2
View in 3D
