Class b: All beta proteins [48724] (174 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (6 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (46 proteins) Pfam PF00595 |
Protein Erbin [82085] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82086] (4 PDB entries) |
Domain d2h3la1: 2h3l A:1310-1412 [136046] automatically matched to d1n7ta_ |
PDB Entry: 2h3l (more details), 1 Å
SCOP Domain Sequences for d2h3la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} gshmghelakqeirvrvekdpelgfsisggvggrgnpfrpdddgifvtrvqpegpaskll qpgdkiiqangysfiniehgqavsllktfqntveliivrevss
Timeline for d2h3la1: