Lineage for d2h3la2 (2h3l A:1314-1412)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2785924Protein Erbin [82085] (1 species)
  7. 2785925Species Human (Homo sapiens) [TaxId:9606] [82086] (4 PDB entries)
  8. 2785926Domain d2h3la2: 2h3l A:1314-1412 [136046]
    Other proteins in same PDB: d2h3la3
    automated match to d1n7ta_

Details for d2h3la2

PDB Entry: 2h3l (more details), 1 Å

PDB Description: crystal structure of erbin pdz
PDB Compounds: (A:) LAP2 protein

SCOPe Domain Sequences for d2h3la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h3la2 b.36.1.1 (A:1314-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]}
ghelakqeirvrvekdpelgfsisggvggrgnpfrpdddgifvtrvqpegpaskllqpgd
kiiqangysfiniehgqavsllktfqntveliivrevss

SCOPe Domain Coordinates for d2h3la2:

Click to download the PDB-style file with coordinates for d2h3la2.
(The format of our PDB-style files is described here.)

Timeline for d2h3la2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h3la3
View in 3D
Domains from other chains:
(mouse over for more information)
d2h3lb_