PDB entry 2h3l

View 2h3l on RCSB PDB site
Description: Crystal Structure of ERBIN PDZ
Class: cell adhesion
Keywords: PDZ Domain
Deposited on 2006-05-22, released 2006-06-13
The last revision prior to the SCOP 1.75 freeze date was dated 2006-08-15, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.148
AEROSPACI score: 1.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LAP2 protein
    Species: HOMO SAPIENS
    Gene: ERBIN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96RT1 (4-102)
      • cloning artifact (0-3)
    Domains in SCOP 1.75: d2h3la1
  • Chain 'B':
    Compound: LAP2 protein
    Species: HOMO SAPIENS
    Gene: ERBIN
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2h3lb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h3lA (A:)
    gshmghelakqeirvrvekdpelgfsisggvggrgnpfrpdddgifvtrvqpegpaskll
    qpgdkiiqangysfiniehgqavsllktfqntveliivrevss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h3lB (B:)
    gshmghelakqeirvrvekdpelgfsisggvggrgnpfrpdddgifvtrvqpegpaskll
    qpgdkiiqangysfiniehgqavsllktfqntveliivrevss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h3lB (B:)
    ghelakqeirvrvekdpelgfsisggvggrgnpfrpdddgifvtrvqpegpaskllqpgd
    kiiqangysfiniehgqavsllktfqntveliivrevs