Lineage for d2h3lb1 (2h3l B:1314-1411)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 797796Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 797797Superfamily b.36.1: PDZ domain-like [50156] (6 families) (S)
    peptide-binding domain
  5. 797798Family b.36.1.1: PDZ domain [50157] (46 proteins)
    Pfam PF00595
  6. 797838Protein Erbin [82085] (1 species)
  7. 797839Species Human (Homo sapiens) [TaxId:9606] [82086] (4 PDB entries)
  8. 797841Domain d2h3lb1: 2h3l B:1314-1411 [136047]
    automatically matched to d1n7ta_

Details for d2h3lb1

PDB Entry: 2h3l (more details), 1 Å

PDB Description: crystal structure of erbin pdz
PDB Compounds: (B:) LAP2 protein

SCOP Domain Sequences for d2h3lb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h3lb1 b.36.1.1 (B:1314-1411) Erbin {Human (Homo sapiens) [TaxId: 9606]}
ghelakqeirvrvekdpelgfsisggvggrgnpfrpdddgifvtrvqpegpaskllqpgd
kiiqangysfiniehgqavsllktfqntveliivrevs

SCOP Domain Coordinates for d2h3lb1:

Click to download the PDB-style file with coordinates for d2h3lb1.
(The format of our PDB-style files is described here.)

Timeline for d2h3lb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2h3la1