Lineage for d2h3lb_ (2h3l B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2379659Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2379660Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2379661Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2379700Protein Erbin [82085] (1 species)
  7. 2379701Species Human (Homo sapiens) [TaxId:9606] [82086] (4 PDB entries)
  8. 2379703Domain d2h3lb_: 2h3l B: [136047]
    Other proteins in same PDB: d2h3la3
    automated match to d1n7ta_

Details for d2h3lb_

PDB Entry: 2h3l (more details), 1 Å

PDB Description: crystal structure of erbin pdz
PDB Compounds: (B:) LAP2 protein

SCOPe Domain Sequences for d2h3lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h3lb_ b.36.1.1 (B:) Erbin {Human (Homo sapiens) [TaxId: 9606]}
ghelakqeirvrvekdpelgfsisggvggrgnpfrpdddgifvtrvqpegpaskllqpgd
kiiqangysfiniehgqavsllktfqntveliivrevs

SCOPe Domain Coordinates for d2h3lb_:

Click to download the PDB-style file with coordinates for d2h3lb_.
(The format of our PDB-style files is described here.)

Timeline for d2h3lb_: