Lineage for d1n7ta_ (1n7t A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 797796Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 797797Superfamily b.36.1: PDZ domain-like [50156] (6 families) (S)
    peptide-binding domain
  5. 797798Family b.36.1.1: PDZ domain [50157] (46 proteins)
    Pfam PF00595
  6. 797838Protein Erbin [82085] (1 species)
  7. 797839Species Human (Homo sapiens) [TaxId:9606] [82086] (4 PDB entries)
  8. 797844Domain d1n7ta_: 1n7t A: [80275]
    complexed with a phage-derived peptide

Details for d1n7ta_

PDB Entry: 1n7t (more details)

PDB Description: erbin pdz domain bound to a phage-derived peptide
PDB Compounds: (A:) 99-mer peptide of densin-180-like protein

SCOP Domain Sequences for d1n7ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n7ta_ b.36.1.1 (A:) Erbin {Human (Homo sapiens) [TaxId: 9606]}
gshmghelakqeirvrvekdpelgfsisggvggrgnpfrpdddgifvtrvqpegpaskll
qpgdkiiqangysfiniehgqavsllktfqntveliivrevss

SCOP Domain Coordinates for d1n7ta_:

Click to download the PDB-style file with coordinates for d1n7ta_.
(The format of our PDB-style files is described here.)

Timeline for d1n7ta_: