![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
![]() | Superfamily b.36.1: PDZ domain-like [50156] (6 families) ![]() peptide-binding domain |
![]() | Family b.36.1.1: PDZ domain [50157] (46 proteins) Pfam PF00595 |
![]() | Protein Erbin [82085] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82086] (4 PDB entries) |
![]() | Domain d1n7ta_: 1n7t A: [80275] complexed with a phage-derived peptide |
PDB Entry: 1n7t (more details)
SCOP Domain Sequences for d1n7ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n7ta_ b.36.1.1 (A:) Erbin {Human (Homo sapiens) [TaxId: 9606]} gshmghelakqeirvrvekdpelgfsisggvggrgnpfrpdddgifvtrvqpegpaskll qpgdkiiqangysfiniehgqavsllktfqntveliivrevss
Timeline for d1n7ta_: