PDB entry 3nfi

View 3nfi on RCSB PDB site
Description: Crystal structure of tandem winged helix domain of RNA polymerase I subunit A49
Class: DNA binding protein, transcription
Keywords: winged helix, transcription, RNA polymerase, DNA binding, DNA BINDING PROTEIN
Deposited on 2010-06-10, released 2010-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-25, with a file datestamp of 2015-03-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase I subunit RPA49
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: N0880, RPA49, RRN13, YNL248C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01080 (Start-236)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d3nfia1, d3nfia2
  • Chain 'B':
    Compound: DNA-directed RNA polymerase I subunit RPA49
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: N0880, RPA49, RRN13, YNL248C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01080 (Start-236)
      • engineered mutation (11)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d3nfib1, d3nfib2
  • Chain 'C':
    Compound: DNA-directed RNA polymerase I subunit RPA49
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: N0880, RPA49, RRN13, YNL248C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01080 (Start-236)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d3nfic1, d3nfic2
  • Chain 'D':
    Compound: DNA-directed RNA polymerase I subunit RPA49
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: N0880, RPA49, RRN13, YNL248C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01080 (Start-236)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d3nfid1, d3nfid2
  • Chain 'E':
    Compound: DNA-directed RNA polymerase I subunit RPA49
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: N0880, RPA49, RRN13, YNL248C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01080 (Start-236)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d3nfie1, d3nfie2
  • Heterogens: PE4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nfiA (A:)
    gshmdlptraqmdeitsndrptplanidatdveqiypiesiipkkelqfirvssilkead
    kekklelfpyqnnskyvakkldsltqpsqmtklqmlyylslllgvyenrrvnnktkller
    lnsppeilvdgilsrftvikpgqfgrskdrsyfidpqnedkilcyilaiimhldnfivei
    tplahelnlkpskvvslfrvlgaivkgatvaqaeafgipkstaasykiatmkvpfkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfiA (A:)
    drptplanidatdveqiypiesiipkkelqfirvssilkeadkekklelfpyqnnskyva
    kkldsltqpsqmtklqmlyylslllgvyenrrvnnktkllerlnsppeilvdgilsrftv
    ikpgqfgrskdrsyfidpqnedkilcyilaiimhldnfiveitplahelnlkpskvvslf
    rvlgaivkgatvaqaeafgipkstaasykiatmkvpfkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nfiB (B:)
    gshmdlptraqmdeitsndrptplanidatdveqiypiesiipkkelqfirvssilkead
    kekklelfpyqnnskyvakkldsltqpsqmtklqmlyylslllgvyenrrvnnktkller
    lnsppeilvdgilsrftvikpgqfgrskdrsyfidpqnedkilcyilaiimhldnfivei
    tplahelnlkpskvvslfrvlgaivkgatvaqaeafgipkstaasykiatmkvpfkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfiB (B:)
    lptraqmdeitsndrptplanidatdveqiypiesiipkkelqfirvssilkeadkekkl
    elfpyqnnskyvakkldsltqpsqmtklqmlyylslllgvyenrrvnnktkllerlnspp
    eilvdgilsrftvikpskdrsyfidpqnedkilcyilaiimhldnfiveitplahelnlk
    pskvvslfrvlgaivkgatvaqaeafgipkstaasykiatmkvpfkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nfiC (C:)
    gshmdlptraqmdeitsndrptplanidatdveqiypiesiipkkelqfirvssilkead
    kekklelfpyqnnskyvakkldsltqpsqmtklqmlyylslllgvyenrrvnnktkller
    lnsppeilvdgilsrftvikpgqfgrskdrsyfidpqnedkilcyilaiimhldnfivei
    tplahelnlkpskvvslfrvlgaivkgatvaqaeafgipkstaasykiatmkvpfkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfiC (C:)
    ndrptplanidatdveqiypiesiipkkelqfirvssilkeadkekklelfpyqnnskyv
    akkldsltqpsqmtklqmlyylslllgvyenrrvnnktkllerlnsppeilvdgilsrft
    vikpgdrsyfidpqnedkilcyilaiimhldnfiveitplahelnlkpskvvslfrvlga
    ivkgatvaqaeafgipkstaasykiatmkvpfkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nfiD (D:)
    gshmdlptraqmdeitsndrptplanidatdveqiypiesiipkkelqfirvssilkead
    kekklelfpyqnnskyvakkldsltqpsqmtklqmlyylslllgvyenrrvnnktkller
    lnsppeilvdgilsrftvikpgqfgrskdrsyfidpqnedkilcyilaiimhldnfivei
    tplahelnlkpskvvslfrvlgaivkgatvaqaeafgipkstaasykiatmkvpfkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfiD (D:)
    ndrptplanidatdveqiypiesiipkkelqfirvssilkeadkekklelfpyqnnskyv
    akkldsltqpsqmtklqmlyylslllgvyenrrvnnktkllerlnsppeilvdgilsrft
    vikpgqfgrskdrsyfidpqnedkilcyilaiimhldnfiveitplahelnlkpskvvsl
    frvlgaivkgatvaqaeafgipkstaasykiatmkvpfkl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3nfiE (E:)
    gshmdlptraqmdeitsndrptplanidatdveqiypiesiipkkelqfirvssilkead
    kekklelfpyqnnskyvakkldsltqpsqmtklqmlyylslllgvyenrrvnnktkller
    lnsppeilvdgilsrftvikpgqfgrskdrsyfidpqnedkilcyilaiimhldnfivei
    tplahelnlkpskvvslfrvlgaivkgatvaqaeafgipkstaasykiatmkvpfkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfiE (E:)
    ndrptplanidatdveqiypiesiipkkelqfirvssilkeadkekklelfpyqnnskyv
    akkldsltqpsqmtklqmlyylslllgvyenrrvnnktkllerlnsppeilvdgilsrft
    vikdrsyfidpqnedkilcyilaiimhldnfiveitplahelnlkpskvvslfrvlgaiv
    kgatvaqaeafgipkstaasykiatmkvpfkl