SCOPe 2.08: Domain d3nfie2: 3nfi E:321-403

Lineage for d3nfie2 (3nfi E:321-403)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.86: RNA polymerase I subunit A49, winged helix domain [345952] (2 proteins)
   C-terminal part of Pfam PF06870
   duplication: tandem repeat of two "winged-helix" domains

6. Protein RNA polymerase I subunit A49, winged helix domain, C-terminal domain [419071] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419563] (1 PDB entry)

8. Domain d3nfie2: 3nfi E:321-403 [344961]
   Other proteins in same PDB: d3nfia1, d3nfib1, d3nfic1, d3nfid1, d3nfie1
   complexed with pe4

Details for d3nfie2

PDB Entry: 3nfi, 1.9 Å

PDB Description: crystal structure of tandem winged helix domain of rna polymerase i subunit a49

PDB Compounds: (E:) DNA-directed RNA polymerase I subunit RPA49

SCOPe Domain Sequences for d3nfie2:

Sequence; same for both SEQRES and ATOM records:

>d3nfie2 a.4.5.86 (E:321-403) RNA polymerase I subunit A49, winged helix domain, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dpqnedkilcyilaiimhldnfiveitplahelnlkpskvvslfrvlgaivkgatvaqae
afgipkstaasykiatmkvpfkl

Timeline for d3nfie2:

• d3nfie2 first appeared in SCOPe 2.07