Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.86: RNA polymerase I subunit A49, winged helix domain [345952] (2 proteins) C-terminal part of Pfam PF06870 duplication: tandem repeat of two "winged-helix" domains |
Protein RNA polymerase I subunit A49, winged helix domain, N-terminal domain [419070] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419562] (1 PDB entry) |
Domain d3nfid1: 3nfi D:184-320 [344958] Other proteins in same PDB: d3nfia2, d3nfib2, d3nfic2, d3nfid2, d3nfie2 complexed with pe4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3nfi (more details), 1.9 Å
SCOPe Domain Sequences for d3nfid1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nfid1 a.4.5.86 (D:184-320) RNA polymerase I subunit A49, winged helix domain, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ndrptplanidatdveqiypiesiipkkelqfirvssilkeadkekklelfpyqnnskyv akkldsltqpsqmtklqmlyylslllgvyenrrvnnktkllerlnsppeilvdgilsrft vikpgqfgrskdrsyfi
Timeline for d3nfid1: