Lineage for d3nfia1 (3nfi A:185-320)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307145Family a.4.5.86: RNA polymerase I subunit A49, winged helix domain [345952] (1 protein)
    C-terminal part of Pfam PF06870
    duplication: tandem repeat of two "winged-helix" domains
  6. 2307146Protein RNA polymerase I subunit A49, winged helix domain [346020] (1 species)
  7. 2307147Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346165] (1 PDB entry)
  8. 2307148Domain d3nfia1: 3nfi A:185-320 [344952]
    complexed with pe4

Details for d3nfia1

PDB Entry: 3nfi (more details), 1.9 Å

PDB Description: crystal structure of tandem winged helix domain of rna polymerase i subunit a49
PDB Compounds: (A:) DNA-directed RNA polymerase I subunit RPA49

SCOPe Domain Sequences for d3nfia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nfia1 a.4.5.86 (A:185-320) RNA polymerase I subunit A49, winged helix domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drptplanidatdveqiypiesiipkkelqfirvssilkeadkekklelfpyqnnskyva
kkldsltqpsqmtklqmlyylslllgvyenrrvnnktkllerlnsppeilvdgilsrftv
ikpgqfgrskdrsyfi

SCOPe Domain Coordinates for d3nfia1:

Click to download the PDB-style file with coordinates for d3nfia1.
(The format of our PDB-style files is described here.)

Timeline for d3nfia1:

  • d3nfia1 is new in SCOPe 2.07-stable