SCOPe 2.08: Domain d3nfie1: 3nfi E:184-320

Lineage for d3nfie1 (3nfi E:184-320)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.86: RNA polymerase I subunit A49, winged helix domain [345952] (2 proteins)
   C-terminal part of Pfam PF06870
   duplication: tandem repeat of two "winged-helix" domains

6. Protein RNA polymerase I subunit A49, winged helix domain, N-terminal domain [419070] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419562] (1 PDB entry)

8. Domain d3nfie1: 3nfi E:184-320 [344960]
   Other proteins in same PDB: d3nfia2, d3nfib2, d3nfic2, d3nfid2, d3nfie2
   complexed with pe4
   has additional insertions and/or extensions that are not grouped together

Details for d3nfie1

PDB Entry: 3nfi, 1.9 Å

PDB Description: crystal structure of tandem winged helix domain of rna polymerase i subunit a49

PDB Compounds: (E:) DNA-directed RNA polymerase I subunit RPA49

SCOPe Domain Sequences for d3nfie1:

Sequence, based on SEQRES records:

>d3nfie1 a.4.5.86 (E:184-320) RNA polymerase I subunit A49, winged helix domain, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ndrptplanidatdveqiypiesiipkkelqfirvssilkeadkekklelfpyqnnskyv
akkldsltqpsqmtklqmlyylslllgvyenrrvnnktkllerlnsppeilvdgilsrft
vikpgqfgrskdrsyfi

Sequence, based on observed residues (ATOM records):

>d3nfie1 a.4.5.86 (E:184-320) RNA polymerase I subunit A49, winged helix domain, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ndrptplanidatdveqiypiesiipkkelqfirvssilkeadkekklelfpyqnnskyv
akkldsltqpsqmtklqmlyylslllgvyenrrvnnktkllerlnsppeilvdgilsrft
vikdrsyfi

Timeline for d3nfie1:

• d3nfie1 first appeared in SCOPe 2.07