SCOPe 2.08: Structural Classification of Proteins

PDB entry 1xxh

View 1xxh on RCSB PDB site
Description: ATPgS Bound E. Coli Clamp Loader Complex
Class: transferase
Keywords: AAA+ ATPase clamp loader, gamma complex, DNA Polymerase III, DNA replication, TRANSFERASE
Deposited on 2004-11-05, released 2004-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: XRAY
Resolution: 3.45 Å
R-factor: 0.315
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: DNA Polymerase III, DELTA SUBUNIT
Species: Escherichia coli [TaxId:562]
Gene: holA
Database cross-references and differences (RAF-indexed):
- Uniprot P28630 (0-End)
  - modified residue (0)
  - modified residue (70)
  - modified residue (222)
  - modified residue (284-285)
Domains in SCOPe 2.08: d1xxha1, d1xxha2
Chain 'B':
Compound: DNA polymerase III subunit gamma
Species: Escherichia coli [TaxId:562]
Gene: dnaX, dnaZ, dnaZX
Database cross-references and differences (RAF-indexed):
- Uniprot P06710
Domains in SCOPe 2.08: d1xxhb1, d1xxhb2
Chain 'C':
Compound: DNA polymerase III subunit gamma
Species: Escherichia coli [TaxId:562]
Gene: dnaX, dnaZ, dnaZX
Database cross-references and differences (RAF-indexed):
- Uniprot P06710
Domains in SCOPe 2.08: d1xxhc1, d1xxhc2
Chain 'D':
Compound: DNA polymerase III subunit gamma
Species: Escherichia coli [TaxId:562]
Gene: dnaX, dnaZ, dnaZX
Database cross-references and differences (RAF-indexed):
- Uniprot P06710
Domains in SCOPe 2.08: d1xxhd1, d1xxhd2
Chain 'E':
Compound: DNA polymerase III, delta prime subunit
Species: Escherichia coli [TaxId:562]
Gene: HOLB
Database cross-references and differences (RAF-indexed):
- Uniprot P28631 (0-333)
  - modified residue (0)
  - modified residue (34)
  - modified residue (67)
  - modified residue (181)
  - modified residue (252)
  - modified residue (300)
Domains in SCOPe 2.08: d1xxhe1, d1xxhe2
Chain 'F':
Compound: DNA Polymerase III, DELTA SUBUNIT
Species: Escherichia coli [TaxId:562]
Gene: holA
Database cross-references and differences (RAF-indexed):
- Uniprot P28630 (0-End)
  - modified residue (0)
  - modified residue (70)
  - modified residue (222)
  - modified residue (284-285)
Domains in SCOPe 2.08: d1xxhf1, d1xxhf2
Chain 'G':
Compound: DNA polymerase III subunit gamma
Species: Escherichia coli [TaxId:562]
Gene: dnaX, dnaZ, dnaZX
Database cross-references and differences (RAF-indexed):
- Uniprot P06710
Domains in SCOPe 2.08: d1xxhg1, d1xxhg2
Chain 'H':
Compound: DNA polymerase III subunit gamma
Species: Escherichia coli [TaxId:562]
Gene: dnaX, dnaZ, dnaZX
Database cross-references and differences (RAF-indexed):
- Uniprot P06710
Domains in SCOPe 2.08: d1xxhh1, d1xxhh2
Chain 'I':
Compound: DNA polymerase III subunit gamma
Species: Escherichia coli [TaxId:562]
Gene: dnaX, dnaZ, dnaZX
Database cross-references and differences (RAF-indexed):
- Uniprot P06710
Domains in SCOPe 2.08: d1xxhi1, d1xxhi2
Chain 'J':
Compound: DNA polymerase III, delta prime subunit
Species: Escherichia coli [TaxId:562]
Gene: HOLB
Database cross-references and differences (RAF-indexed):
- Uniprot P28631 (0-333)
  - modified residue (0)
  - modified residue (34)
  - modified residue (67)
  - modified residue (181)
  - modified residue (252)
  - modified residue (300)
Domains in SCOPe 2.08: d1xxhj1, d1xxhj2
Heterogens: ZN, PO4, AGS

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1xxhA (A:)
mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd
wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska
qenaawftalanrsvqvtcqtpeqaqlprwvaarakqlnlelddaanqvlcycyegnlla
laqalerlsllwpdgkltlprveqavndaahftpfhwvdallmgkskralhilqqlrleg
sepvillrtlqrellllvnlkrqsahtplralfdkhrvwqnrrgmmgealnrlsqtqlrq
avqlltrteltlkqdygqsvwaeleglslllchkpladvfidg