| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily) core: 5 helices: bundle |
Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) ![]() associated with N-terminal domain from the AAA+ family of P-loop hydrolases |
| Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins) contains an extra helix |
| Protein delta subunit [63580] (1 species) |
| Species Escherichia coli [TaxId:562] [63581] (4 PDB entries) Uniprot P28630 |
| Domain d1xxhf1: 1xxh F:212-338 [116173] Other proteins in same PDB: d1xxha2, d1xxhb1, d1xxhb2, d1xxhc1, d1xxhc2, d1xxhd1, d1xxhd2, d1xxhe1, d1xxhe2, d1xxhf2, d1xxhg1, d1xxhg2, d1xxhh1, d1xxhh2, d1xxhi1, d1xxhi2, d1xxhj1, d1xxhj2 protein/DNA complex; complexed with ags, po4, zn |
PDB Entry: 1xxh (more details), 3.45 Å
SCOPe Domain Sequences for d1xxhf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xxhf1 a.80.1.1 (F:212-338) delta subunit {Escherichia coli [TaxId: 562]}
ftpfhwvdallmgkskralhilqqlrlegsepvillrtlqrellllvnlkrqsahtplra
lfdkhrvwqnrrgmmgealnrlsqtqlrqavqlltrteltlkqdygqsvwaeleglslll
chkplad
Timeline for d1xxhf1: