Class a: All alpha proteins [46456] (290 folds) |
Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily) core: 5 helices: bundle |
Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) associated with N-terminal domain from the AAA+ family of P-loop hydrolases |
Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins) contains an extra helix |
Protein gamma subunit [63578] (2 species) |
Species Escherichia coli [TaxId:562] [63579] (3 PDB entries) Uniprot P06710 5-368 |
Domain d1xxhc1: 1xxh C:243-368 [116167] Other proteins in same PDB: d1xxha1, d1xxha2, d1xxhb2, d1xxhc2, d1xxhd2, d1xxhe1, d1xxhe2, d1xxhf1, d1xxhf2, d1xxhg2, d1xxhh2, d1xxhi2, d1xxhj1, d1xxhj2 protein/DNA complex; complexed with ags, po4, zn |
PDB Entry: 1xxh (more details), 3.45 Å
SCOPe Domain Sequences for d1xxhc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xxhc1 a.80.1.1 (C:243-368) gamma subunit {Escherichia coli [TaxId: 562]} tldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaal gndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhpr mplpep
Timeline for d1xxhc1: