SCOPe 2.08: Domain d1xxha1: 1xxh A:212-338

Lineage for d1xxha1 (1xxh A:212-338)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
   core: 5 helices: bundle

4. Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families)
   associated with N-terminal domain from the AAA+ family of P-loop hydrolases

5. Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
   contains an extra helix

6. Protein delta subunit [63580] (1 species)

7. Species Escherichia coli [TaxId:562] [63581] (4 PDB entries)
   Uniprot P28630

8. Domain d1xxha1: 1xxh A:212-338 [116163]
   Other proteins in same PDB: d1xxha2, d1xxhb1, d1xxhb2, d1xxhc1, d1xxhc2, d1xxhd1, d1xxhd2, d1xxhe1, d1xxhe2, d1xxhf2, d1xxhg1, d1xxhg2, d1xxhh1, d1xxhh2, d1xxhi1, d1xxhi2, d1xxhj1, d1xxhj2
   protein/DNA complex; complexed with ags, po4, zn

Details for d1xxha1

PDB Entry: 1xxh, 3.45 Å

PDB Description: ATPgS Bound E. Coli Clamp Loader Complex

PDB Compounds: (A:) DNA Polymerase III, DELTA SUBUNIT

SCOPe Domain Sequences for d1xxha1:

Sequence; same for both SEQRES and ATOM records:

>d1xxha1 a.80.1.1 (A:212-338) delta subunit {Escherichia coli [TaxId: 562]}
ftpfhwvdallmgkskralhilqqlrlegsepvillrtlqrellllvnlkrqsahtplra
lfdkhrvwqnrrgmmgealnrlsqtqlrqavqlltrteltlkqdygqsvwaeleglslll
chkplad

Timeline for d1xxha1:

• d1xxha1 first appeared in SCOP 1.71
  
• d1xxha1 appears in SCOPe 2.07