Lineage for d1xxha1 (1xxh A:212-338)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001760Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 2001761Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 2001762Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 protein domains)
    contains an extra helix
  6. 2001771Protein delta subunit [63580] (1 species)
  7. 2001772Species Escherichia coli [TaxId:562] [63581] (4 PDB entries)
    Uniprot P28630
  8. 2001776Domain d1xxha1: 1xxh A:212-338 [116163]
    Other proteins in same PDB: d1xxha2, d1xxhb1, d1xxhb2, d1xxhc1, d1xxhc2, d1xxhd1, d1xxhd2, d1xxhe1, d1xxhe2, d1xxhf2, d1xxhg1, d1xxhg2, d1xxhh1, d1xxhh2, d1xxhi1, d1xxhi2, d1xxhj1, d1xxhj2
    protein/DNA complex; complexed with ags, po4, zn

Details for d1xxha1

PDB Entry: 1xxh (more details), 3.45 Å

PDB Description: ATPgS Bound E. Coli Clamp Loader Complex
PDB Compounds: (A:) DNA Polymerase III, DELTA SUBUNIT

SCOPe Domain Sequences for d1xxha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxha1 a.80.1.1 (A:212-338) delta subunit {Escherichia coli [TaxId: 562]}
ftpfhwvdallmgkskralhilqqlrlegsepvillrtlqrellllvnlkrqsahtplra
lfdkhrvwqnrrgmmgealnrlsqtqlrqavqlltrteltlkqdygqsvwaeleglslll
chkplad

SCOPe Domain Coordinates for d1xxha1:

Click to download the PDB-style file with coordinates for d1xxha1.
(The format of our PDB-style files is described here.)

Timeline for d1xxha1: