SCOPe 2.08: Domain d1xxhd2: 1xxh D:5-242

Lineage for d1xxhd2 (1xxh D:5-242)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein gamma subunit of DNA polymerase III, N-domain [64031] (2 species)

7. Species Escherichia coli [TaxId:562] [64032] (3 PDB entries)
   Uniprot P06710 5-368

8. Domain d1xxhd2: 1xxh D:5-242 [116170]
   Other proteins in same PDB: d1xxha1, d1xxha2, d1xxhb1, d1xxhc1, d1xxhd1, d1xxhe1, d1xxhe2, d1xxhf1, d1xxhf2, d1xxhg1, d1xxhh1, d1xxhi1, d1xxhj1, d1xxhj2
   protein/DNA complex; complexed with ags, po4, zn

Details for d1xxhd2

PDB Entry: 1xxh, 3.45 Å

PDB Description: ATPgS Bound E. Coli Clamp Loader Complex

PDB Compounds: (D:) DNA polymerase III subunit gamma

SCOPe Domain Sequences for d1xxhd2:

Sequence; same for both SEQRES and ATOM records:

>d1xxhd2 c.37.1.20 (D:5-242) gamma subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}
vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlg

Timeline for d1xxhd2:

• d1xxhd2 first appeared in SCOP 1.71
  
• d1xxhd2 appears in SCOPe 2.07