PDB entry 1ulq

View 1ulq on RCSB PDB site
Description: Crystal structure of tt0182 from Thermus thermophilus HB8
Class: transferase
Keywords: transferase, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2003-09-16, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.218
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative acetyl-CoA acetyltransferase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ulqa1, d1ulqa2
  • Chain 'B':
    Compound: putative acetyl-CoA acetyltransferase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ulqb1, d1ulqb2
  • Chain 'C':
    Compound: putative acetyl-CoA acetyltransferase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ulqc1, d1ulqc2
  • Chain 'D':
    Compound: putative acetyl-CoA acetyltransferase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ulqd1, d1ulqd2
  • Chain 'E':
    Compound: putative acetyl-CoA acetyltransferase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ulqe1, d1ulqe2
  • Chain 'F':
    Compound: putative acetyl-CoA acetyltransferase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ulqf1, d1ulqf2
  • Chain 'G':
    Compound: putative acetyl-CoA acetyltransferase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ulqg1, d1ulqg2
  • Chain 'H':
    Compound: putative acetyl-CoA acetyltransferase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ulqh1, d1ulqh2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ulqA (A:)
    mpeawiveavrtpigkhggalasvrpddllahalsvlvdrsgvpkeevedvyagcanqag
    ednrnvarmalllagfpvevagctvnrlcgsgleavaqaaraiwagegkvyigsgvesms
    rapyavpkpergfptgnlvmydttlgwrfvnpkmqalygtesmgetaenlaemygirree
    qdrfallshqkavraweegrfqdevvpvpvkrgkeeilveqdegprrdtsleklaalrpv
    freggtvtagnssplndgaaavllvsddyakahglrplarvraiavagvpprimgigpvp
    atrkaleraglsfsdlglielneafaaqalavlrewslsmedqrlnpnggaialghplga
    sgarilttlvhemrrrkvqfglatmcigvgqgiavvvegmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ulqA (A:)
    eawiveavrtpigkhggalasvrpddllahalsvlvdrsgvpkeevedvyagcanqaged
    nrnvarmalllagfpvevagctvnrlcgsgleavaqaaraiwagegkvyigsgvesmsra
    pyavpkpergfptgnlvmydttlgwrfvnpkmqalygtesmgetaenlaemygirreeqd
    rfallshqkavraweegrfqdevvpvpvkrgkeeilveqdegprrdtsleklaalrpvfr
    eggtvtagnssplndgaaavllvsddyakahglrplarvraiavagvpprimgigpvpat
    rkaleraglsfsdlglielneafaaqalavlrewslsmedqrlnpnggaialghplgasg
    arilttlvhemrrrkvqfglatmcigvgqgiavvvegm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ulqB (B:)
    mpeawiveavrtpigkhggalasvrpddllahalsvlvdrsgvpkeevedvyagcanqag
    ednrnvarmalllagfpvevagctvnrlcgsgleavaqaaraiwagegkvyigsgvesms
    rapyavpkpergfptgnlvmydttlgwrfvnpkmqalygtesmgetaenlaemygirree
    qdrfallshqkavraweegrfqdevvpvpvkrgkeeilveqdegprrdtsleklaalrpv
    freggtvtagnssplndgaaavllvsddyakahglrplarvraiavagvpprimgigpvp
    atrkaleraglsfsdlglielneafaaqalavlrewslsmedqrlnpnggaialghplga
    sgarilttlvhemrrrkvqfglatmcigvgqgiavvvegmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ulqB (B:)
    eawiveavrtpigkhggalasvrpddllahalsvlvdrsgvpkeevedvyagcanqaged
    nrnvarmalllagfpvevagctvnrlcgsgleavaqaaraiwagegkvyigsgvesmsra
    pyavpkpergfptgnlvmydttlgwrfvnpkmqalygtesmgetaenlaemygirreeqd
    rfallshqkavraweegrfqdevvpvpvkrgkeeilveqdegprrdtsleklaalrpvfr
    eggtvtagnssplndgaaavllvsddyakahglrplarvraiavagvpprimgigpvpat
    rkaleraglsfsdlglielneafaaqalavlrewslsmedqrlnpnggaialghplgasg
    arilttlvhemrrrkvqfglatmcigvgqgiavvvegm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ulqC (C:)
    mpeawiveavrtpigkhggalasvrpddllahalsvlvdrsgvpkeevedvyagcanqag
    ednrnvarmalllagfpvevagctvnrlcgsgleavaqaaraiwagegkvyigsgvesms
    rapyavpkpergfptgnlvmydttlgwrfvnpkmqalygtesmgetaenlaemygirree
    qdrfallshqkavraweegrfqdevvpvpvkrgkeeilveqdegprrdtsleklaalrpv
    freggtvtagnssplndgaaavllvsddyakahglrplarvraiavagvpprimgigpvp
    atrkaleraglsfsdlglielneafaaqalavlrewslsmedqrlnpnggaialghplga
    sgarilttlvhemrrrkvqfglatmcigvgqgiavvvegmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ulqC (C:)
    peawiveavrtpigkhggalasvrpddllahalsvlvdrsgvpkeevedvyagcanqage
    dnrnvarmalllagfpvevagctvnrlcgsgleavaqaaraiwagegkvyigsgvesmsr
    apyavpkpergfptgnlvmydttlgwrfvnpkmqalygtesmgetaenlaemygirreeq
    drfallshqkavraweegrfqdevvpvpvkrgkeeilveqdegprrdtsleklaalrpvf
    reggtvtagnssplndgaaavllvsddyakahglrplarvraiavagvpprimgigpvpa
    trkaleraglsfsdlglielneafaaqalavlrewslsmedqrlnpnggaialghplgas
    garilttlvhemrrrkvqfglatmcigvgqgiavvvegm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ulqD (D:)
    mpeawiveavrtpigkhggalasvrpddllahalsvlvdrsgvpkeevedvyagcanqag
    ednrnvarmalllagfpvevagctvnrlcgsgleavaqaaraiwagegkvyigsgvesms
    rapyavpkpergfptgnlvmydttlgwrfvnpkmqalygtesmgetaenlaemygirree
    qdrfallshqkavraweegrfqdevvpvpvkrgkeeilveqdegprrdtsleklaalrpv
    freggtvtagnssplndgaaavllvsddyakahglrplarvraiavagvpprimgigpvp
    atrkaleraglsfsdlglielneafaaqalavlrewslsmedqrlnpnggaialghplga
    sgarilttlvhemrrrkvqfglatmcigvgqgiavvvegmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ulqD (D:)
    peawiveavrtpigkhggalasvrpddllahalsvlvdrsgvpkeevedvyagcanqage
    dnrnvarmalllagfpvevagctvnrlcgsgleavaqaaraiwagegkvyigsgvesmsr
    apyavpkpergfptgnlvmydttlgwrfvnpkmqalygtesmgetaenlaemygirreeq
    drfallshqkavraweegrfqdevvpvpvkrgkeeilveqdegprrdtsleklaalrpvf
    reggtvtagnssplndgaaavllvsddyakahglrplarvraiavagvpprimgigpvpa
    trkaleraglsfsdlglielneafaaqalavlrewslsmedqrlnpnggaialghplgas
    garilttlvhemrrrkvqfglatmcigvgqgiavvvegm
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ulqE (E:)
    mpeawiveavrtpigkhggalasvrpddllahalsvlvdrsgvpkeevedvyagcanqag
    ednrnvarmalllagfpvevagctvnrlcgsgleavaqaaraiwagegkvyigsgvesms
    rapyavpkpergfptgnlvmydttlgwrfvnpkmqalygtesmgetaenlaemygirree
    qdrfallshqkavraweegrfqdevvpvpvkrgkeeilveqdegprrdtsleklaalrpv
    freggtvtagnssplndgaaavllvsddyakahglrplarvraiavagvpprimgigpvp
    atrkaleraglsfsdlglielneafaaqalavlrewslsmedqrlnpnggaialghplga
    sgarilttlvhemrrrkvqfglatmcigvgqgiavvvegmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ulqE (E:)
    peawiveavrtpigkhggalasvrpddllahalsvlvdrsgvpkeevedvyagcanqage
    dnrnvarmalllagfpvevagctvnrlcgsgleavaqaaraiwagegkvyigsgvesmsr
    apyavpkpergfptgnlvmydttlgwrfvnpkmqalygtesmgetaenlaemygirreeq
    drfallshqkavraweegrfqdevvpvpvkrgkeeilveqdegprrdtsleklaalrpvf
    reggtvtagnssplndgaaavllvsddyakahglrplarvraiavagvpprimgigpvpa
    trkaleraglsfsdlglielneafaaqalavlrewslsmedqrlnpnggaialghplgas
    garilttlvhemrrrkvqfglatmcigvgqgiavvvegm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ulqF (F:)
    mpeawiveavrtpigkhggalasvrpddllahalsvlvdrsgvpkeevedvyagcanqag
    ednrnvarmalllagfpvevagctvnrlcgsgleavaqaaraiwagegkvyigsgvesms
    rapyavpkpergfptgnlvmydttlgwrfvnpkmqalygtesmgetaenlaemygirree
    qdrfallshqkavraweegrfqdevvpvpvkrgkeeilveqdegprrdtsleklaalrpv
    freggtvtagnssplndgaaavllvsddyakahglrplarvraiavagvpprimgigpvp
    atrkaleraglsfsdlglielneafaaqalavlrewslsmedqrlnpnggaialghplga
    sgarilttlvhemrrrkvqfglatmcigvgqgiavvvegmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ulqF (F:)
    eawiveavrtpigkhggalasvrpddllahalsvlvdrsgvpkeevedvyagcanqaged
    nrnvarmalllagfpvevagctvnrlcgsgleavaqaaraiwagegkvyigsgvesmsra
    pyavpkpergfptgnlvmydttlgwrfvnpkmqalygtesmgetaenlaemygirreeqd
    rfallshqkavraweegrfqdevvpvpvkrgkeeilveqdegprrdtsleklaalrpvfr
    eggtvtagnssplndgaaavllvsddyakahglrplarvraiavagvpprimgigpvpat
    rkaleraglsfsdlglielneafaaqalavlrewslsmedqrlnpnggaialghplgasg
    arilttlvhemrrrkvqfglatmcigvgqgiavvvegm
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ulqG (G:)
    mpeawiveavrtpigkhggalasvrpddllahalsvlvdrsgvpkeevedvyagcanqag
    ednrnvarmalllagfpvevagctvnrlcgsgleavaqaaraiwagegkvyigsgvesms
    rapyavpkpergfptgnlvmydttlgwrfvnpkmqalygtesmgetaenlaemygirree
    qdrfallshqkavraweegrfqdevvpvpvkrgkeeilveqdegprrdtsleklaalrpv
    freggtvtagnssplndgaaavllvsddyakahglrplarvraiavagvpprimgigpvp
    atrkaleraglsfsdlglielneafaaqalavlrewslsmedqrlnpnggaialghplga
    sgarilttlvhemrrrkvqfglatmcigvgqgiavvvegmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ulqG (G:)
    peawiveavrtpigkhggalasvrpddllahalsvlvdrsgvpkeevedvyagcanqage
    dnrnvarmalllagfpvevagctvnrlcgsgleavaqaaraiwagegkvyigsgvesmsr
    apyavpkpergfptgnlvmydttlgwrfvnpkmqalygtesmgetaenlaemygirreeq
    drfallshqkavraweegrfqdevvpvpvkrgkeeilveqdegprrdtsleklaalrpvf
    reggtvtagnssplndgaaavllvsddyakahglrplarvraiavagvpprimgigpvpa
    trkaleraglsfsdlglielneafaaqalavlrewslsmedqrlnpnggaialghplgas
    garilttlvhemrrrkvqfglatmcigvgqgiavvvegm
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ulqH (H:)
    mpeawiveavrtpigkhggalasvrpddllahalsvlvdrsgvpkeevedvyagcanqag
    ednrnvarmalllagfpvevagctvnrlcgsgleavaqaaraiwagegkvyigsgvesms
    rapyavpkpergfptgnlvmydttlgwrfvnpkmqalygtesmgetaenlaemygirree
    qdrfallshqkavraweegrfqdevvpvpvkrgkeeilveqdegprrdtsleklaalrpv
    freggtvtagnssplndgaaavllvsddyakahglrplarvraiavagvpprimgigpvp
    atrkaleraglsfsdlglielneafaaqalavlrewslsmedqrlnpnggaialghplga
    sgarilttlvhemrrrkvqfglatmcigvgqgiavvvegmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ulqH (H:)
    peawiveavrtpigkhggalasvrpddllahalsvlvdrsgvpkeevedvyagcanqage
    dnrnvarmalllagfpvevagctvnrlcgsgleavaqaaraiwagegkvyigsgvesmsr
    apyavpkpergfptgnlvmydttlgwrfvnpkmqalygtesmgetaenlaemygirreeq
    drfallshqkavraweegrfqdevvpvpvkrgkeeilveqdegprrdtsleklaalrpvf
    reggtvtagnssplndgaaavllvsddyakahglrplarvraiavagvpprimgigpvpa
    trkaleraglsfsdlglielneafaaqalavlrewslsmedqrlnpnggaialghplgas
    garilttlvhemrrrkvqfglatmcigvgqgiavvvegm