| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.1: Thiolase-related [53902] (20 proteins) |
| Protein Beta-ketoadipyl CoA thiolase, N-terminal domain [419018] (1 species) |
| Species Thermus thermophilus [TaxId:274] [419500] (1 PDB entry) Uniprot Q5SJM1 |
| Domain d1ulqc1: 1ulq C:2-275 [113271] Other proteins in same PDB: d1ulqa2, d1ulqb2, d1ulqc2, d1ulqd2, d1ulqe2, d1ulqf2, d1ulqg2, d1ulqh2 Structural genomics target has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1ulq (more details), 3 Å
SCOPe Domain Sequences for d1ulqc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ulqc1 c.95.1.1 (C:2-275) Beta-ketoadipyl CoA thiolase, N-terminal domain {Thermus thermophilus [TaxId: 274]}
peawiveavrtpigkhggalasvrpddllahalsvlvdrsgvpkeevedvyagcanqage
dnrnvarmalllagfpvevagctvnrlcgsgleavaqaaraiwagegkvyigsgvesmsr
apyavpkpergfptgnlvmydttlgwrfvnpkmqalygtesmgetaenlaemygirreeq
drfallshqkavraweegrfqdevvpvpvkrgkeeilveqdegprrdtsleklaalrpvf
reggtvtagnssplndgaaavllvsddyakahgl
Timeline for d1ulqc1: