SCOPe 2.08: Domain d1ulqe2: 1ulq E:276-400

Lineage for d1ulqe2 (1ulq E:276-400)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Beta-ketoadipyl CoA thiolase, C-terminal domain [419019] (1 species)
7. Species Thermus thermophilus [TaxId:274] [419501] (1 PDB entry)
   Uniprot Q5SJM1

8. Domain d1ulqe2: 1ulq E:276-400 [113276]
   Other proteins in same PDB: d1ulqa1, d1ulqb1, d1ulqc1, d1ulqd1, d1ulqe1, d1ulqf1, d1ulqg1, d1ulqh1
   Structural genomics target

Details for d1ulqe2

PDB Entry: 1ulq, 3 Å

PDB Description: Crystal structure of tt0182 from Thermus thermophilus HB8

PDB Compounds: (E:) putative acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d1ulqe2:

Sequence; same for both SEQRES and ATOM records:

>d1ulqe2 c.95.1.1 (E:276-400) Beta-ketoadipyl CoA thiolase, C-terminal domain {Thermus thermophilus [TaxId: 274]}
rplarvraiavagvpprimgigpvpatrkaleraglsfsdlglielneafaaqalavlre
wslsmedqrlnpnggaialghplgasgarilttlvhemrrrkvqfglatmcigvgqgiav
vvegm

Timeline for d1ulqe2:

• d1ulqe2 first appeared in SCOP 1.71
  
• d1ulqe2 appears in SCOPe 2.07