Lineage for d1ulqb1 (1ulq B:3-275)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)
  6. Protein Beta-ketoadipyl CoA thiolase, N-terminal domain [419018] (1 species)
  7. Species Thermus thermophilus [TaxId:274] [419500] (1 PDB entry)
    Uniprot Q5SJM1
  8. Domain d1ulqb1: 1ulq B:3-275 [113269]
    Other proteins in same PDB: d1ulqa2, d1ulqb2, d1ulqc2, d1ulqd2, d1ulqe2, d1ulqf2, d1ulqg2, d1ulqh2
    Structural genomics target
    has additional insertions and/or extensions that are not grouped together

Details for d1ulqb1

PDB Entry: 1ulq (more details), 3 Å

PDB Description: Crystal structure of tt0182 from Thermus thermophilus HB8
PDB Compounds: (B:) putative acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d1ulqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulqb1 c.95.1.1 (B:3-275) Beta-ketoadipyl CoA thiolase, N-terminal domain {Thermus thermophilus [TaxId: 274]}
eawiveavrtpigkhggalasvrpddllahalsvlvdrsgvpkeevedvyagcanqaged
nrnvarmalllagfpvevagctvnrlcgsgleavaqaaraiwagegkvyigsgvesmsra
pyavpkpergfptgnlvmydttlgwrfvnpkmqalygtesmgetaenlaemygirreeqd
rfallshqkavraweegrfqdevvpvpvkrgkeeilveqdegprrdtsleklaalrpvfr
eggtvtagnssplndgaaavllvsddyakahgl

SCOPe Domain Coordinates for d1ulqb1 are not available.

Timeline for d1ulqb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ulqb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1ulqa1, d1ulqa2, d1ulqc1, d1ulqc2, d1ulqd1, d1ulqd2, d1ulqe1, d1ulqe2, d1ulqf1, d1ulqf2, d1ulqg1, d1ulqg2, d1ulqh1, d1ulqh2