Lineage for d1ulqd2 (1ulq D:276-400)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916471Family c.95.1.1: Thiolase-related [53902] (20 proteins)
  6. Protein Beta-ketoadipyl CoA thiolase, C-terminal domain [419019] (1 species)
  7. Species Thermus thermophilus [TaxId:274] [419501] (1 PDB entry)
    Uniprot Q5SJM1
  8. 2916727Domain d1ulqd2: 1ulq D:276-400 [113274]
    Other proteins in same PDB: d1ulqa1, d1ulqb1, d1ulqc1, d1ulqd1, d1ulqe1, d1ulqf1, d1ulqg1, d1ulqh1
    Structural genomics target

Details for d1ulqd2

PDB Entry: 1ulq (more details), 3 Å

PDB Description: Crystal structure of tt0182 from Thermus thermophilus HB8
PDB Compounds: (D:) putative acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d1ulqd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulqd2 c.95.1.1 (D:276-400) Beta-ketoadipyl CoA thiolase, C-terminal domain {Thermus thermophilus [TaxId: 274]}
rplarvraiavagvpprimgigpvpatrkaleraglsfsdlglielneafaaqalavlre
wslsmedqrlnpnggaialghplgasgarilttlvhemrrrkvqfglatmcigvgqgiav
vvegm

SCOPe Domain Coordinates for d1ulqd2:

Click to download the PDB-style file with coordinates for d1ulqd2.
(The format of our PDB-style files is described here.)

Timeline for d1ulqd2: