PDB entry 1ltx

View 1ltx on RCSB PDB site
Description: Structure of Rab Escort Protein-1 in complex with Rab geranylgeranyl transferase and isoprenoid
Class: Transferase/Protein binding
Keywords: RAB PRENYLATION, PRENYLTRANSFERASE, LUCINE-RICH REPEATS, POST-TRANSLATIONAL MODIFICATION, Transferase-Protein binding COMPLEX
Deposited on 2002-05-21, released 2003-05-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rab geranylgeranyltransferase alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ltxa1, d1ltxa2, d1ltxa3
  • Chain 'B':
    Compound: rab geranylgeranyltransferase beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ltxb_
  • Chain 'P':
    Compound: aaaa
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1LTX (0-3)
  • Chain 'R':
    Compound: Rab Escort Protein 1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37727
      • engineered (230)
      • engineered (472)
      • engineered (482)
    Domains in SCOPe 2.07: d1ltxr1, d1ltxr2
  • Heterogens: ZN, CL, FAR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ltxA (A:)
    mhgrlkvktseeqaeakrlereqklklyqsatqavfqkrqageldesvleltsqilganp
    dfatlwncrrevlqhletekspeesaalvkaelgflesclrvnpksygtwhhrcwllsrl
    pepnwarelelcarfleadernfhcwdyrrfvaaqaavapaeelaftdslitrnfsnyss
    whyrscllpqlhpqpdsgpqgrlpenvllkelelvqnafftdpndqsawfyhrwllgrae
    phdvlccvhvsreeaclsvcfsrpltvgsrmgtlllmvdeaplsvewrtpdgrnrpshvw
    lcdlpaaslndqlpqhtfrviwtgsdsqkecvllkdrpecwcrdsatdeqlfrcelsvek
    stvlqselesckelqelepenkwclltiillmraldpllyeketlqyfstlkavdpmraa
    ylddlrskfllensvlkmeyadvrvlhlahkdltvlchleqlllvthldlshnrlralpp
    alaalrclevlqasdnalenvdgvanlprlqelllcnnrlqqsaaiqplvscprlvllnl
    qgnslcqeegiqerlaemlpsvssilt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ltxA (A:)
    klklyqsatqavfqkrqageldesvleltsqilganpdfatlwncrrevlqhletekspe
    esaalvkaelgflesclrvnpksygtwhhrcwllsrlpepnwarelelcarfleadernf
    hcwdyrrfvaaqaavapaeelaftdslitrnfsnysswhyrscllpqlhpqgrlpenvll
    kelelvqnafftdpndqsawfyhrwllgraepvlccvhvsreeaclsvcfsrpltvgsrm
    gtlllmvdeaplsvewrtpdgrnrpshvwlcdlpaaslndqlpqhtfrviwtgsdsqkec
    vllkdrpecwcrdsatdeqlfrcelsvekstvlqselesckelqelepenkwclltiill
    mraldpllyeketlqyfstlkavdpmraaylddlrskfllensvlkmeyadvrvlhlahk
    dltvlchleqlllvthldlshnrlralppalaalrclevlqasdnalenvdgvanlprlq
    elllcnnrlqqsaaiqplvscprlvllnlqgnslcqeegiqerlaemlpsvssilt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ltxB (B:)
    mgtqqkdvtiksdapdtlllekhadyiasygskkddyeycmseylrmsgvywgltvmdlm
    gqlhrmnkeeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvv
    ayvqslqkedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdgg
    fgcrpgseshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvc
    yswwvlaslkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsl
    lgeeqikpvspvfcmpeevlqrvnvqpelvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ltxB (B:)
    kdvtiksdpdtlllekhadyiasygscmseylrmsgvywgltvmdlmgqlhrmnkeeilv
    fikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvvayvqslqkedgsf
    agdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggfgcrpgseshagq
    iycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcyswwvlaslkiig
    rlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsllgeeqikpvspvf
    cmpeevlqrvnvqpelvs
    

  • Chain 'P':
    No sequence available.

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1ltxR (R:)
    madnlpsdfdvivigtglpesiiaaacsrsgqrvlhvdsrsyyggnwasfsfsgllswlk
    eyqenndvvtensmwqeqileneeaiplsskdktiqhvevfcyasqdlhkdveeagalqk
    nhasvtsaqsaeaaeaaetsclptaveplsmgsceipaeqsqcpgpesspevndaeatgk
    kensdakssteepsenvpkvqdntetpkknritysqiikegrrfnidlvskllysrglli
    dlliksnvsryaefknitrilafregtveqvpcsradvfnskqltmvekrmlmkfltfcv
    eyeehpdeyrayegttfseylktqkltpnlqyfvlhsiamtsettsctvdglkatkkflq
    clgrygntpflfplygqgelpqcfcrmcavfggiyclrhsvqclvvdkesrkckavidqf
    gqriiskhfiiedsylsentcsrvqyrqisravlitdgsvlktdadqqvsiltvpaeepg
    sfavrvielcsstmtcmkgtylvhltcmssktaredlervvqklftpyteieaeneqvek
    prllwalyfnmrdssdisrdcyndlpsnvyvcsgpdsglgndnavkqaetlfqqicpned
    fcpappnpedivldgdssqqevpessvtpetnsetpkestvlgnpeepse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ltxR (R:)
    adnlpsdfdvivigtglpesiiaaacsrsgqrvlhvdsrsyyggnwasfsfsgllswlke
    yqentensmwqeqileneeaiplsskdktiqhvevfcyasqdknritysqiikegrrfni
    dlvskllysrgllidlliksnvsryaefknitrilafregtveqvpcsradvfnskqltm
    vekrmlmkfltfcveyeehpdeyrayegttfseylktqkltpnlqyfvlhsiamtstsct
    vdglkatkkflqclgrygntpflfplygqgelpqcfcrmcavfggiyclrhsvqclvvdk
    esrkckavidqfgqriiskhfiiedsylsentcsrvqyrqisravlitdgsvlktdadqq
    vsiltvpaeepgsfavrvielcsstmtcmkgtylvhltcmssktaredlervvqklftpy
    teieekprllwalyfnmrdssdisrdcyndlpsnvyvcsgpdsglgndnavkqaetlfqq
    icpnedfpedivld