Lineage for d1ltxa1 (1ltx A:24-241,A:351-443)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007074Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) (S)
  5. 2007075Family a.118.6.1: Protein prenylyltransferase [48440] (3 protein domains)
  6. 2007193Protein Rab geranylgeranyltransferase alpha-subunit, N-terminal domain [48443] (1 species)
  7. 2007194Species Norway rat (Rattus norvegicus) [TaxId:10116] [48444] (2 PDB entries)
  8. 2007197Domain d1ltxa1: 1ltx A:24-241,A:351-443 [84711]
    Other proteins in same PDB: d1ltxa2, d1ltxa3, d1ltxb_, d1ltxr1, d1ltxr2
    complexed with cl, far, zn

Details for d1ltxa1

PDB Entry: 1ltx (more details), 2.7 Å

PDB Description: structure of rab escort protein-1 in complex with rab geranylgeranyl transferase and isoprenoid
PDB Compounds: (A:) rab geranylgeranyltransferase alpha subunit

SCOPe Domain Sequences for d1ltxa1:

Sequence, based on SEQRES records: (download)

>d1ltxa1 a.118.6.1 (A:24-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
klklyqsatqavfqkrqageldesvleltsqilganpdfatlwncrrevlqhletekspe
esaalvkaelgflesclrvnpksygtwhhrcwllsrlpepnwarelelcarfleadernf
hcwdyrrfvaaqaavapaeelaftdslitrnfsnysswhyrscllpqlhpqpdsgpqgrl
penvllkelelvqnafftdpndqsawfyhrwllgraepXlfrcelsvekstvlqselesc
kelqelepenkwclltiillmraldpllyeketlqyfstlkavdpmraaylddlrskfll
ensvlkmeyadv

Sequence, based on observed residues (ATOM records): (download)

>d1ltxa1 a.118.6.1 (A:24-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
klklyqsatqavfqkrqageldesvleltsqilganpdfatlwncrrevlqhletekspe
esaalvkaelgflesclrvnpksygtwhhrcwllsrlpepnwarelelcarfleadernf
hcwdyrrfvaaqaavapaeelaftdslitrnfsnysswhyrscllpqlhpqgrlpenvll
kelelvqnafftdpndqsawfyhrwllgraepXlfrcelsvekstvlqselesckelqel
epenkwclltiillmraldpllyeketlqyfstlkavdpmraaylddlrskfllensvlk
meyadv

SCOPe Domain Coordinates for d1ltxa1:

Click to download the PDB-style file with coordinates for d1ltxa1.
(The format of our PDB-style files is described here.)

Timeline for d1ltxa1: