Lineage for d1ltxr1 (1ltx R:2-444,R:558-614)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2096453Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2096454Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2096865Family c.3.1.3: GDI-like N domain [51931] (3 protein domains)
    Similar to FAD-linked reductases in both domains but does not bind FAD
  6. 2096876Protein Rab escort protein 1 [89546] (1 species)
  7. 2096877Species Norway rat (Rattus norvegicus) [TaxId:10116] [89547] (3 PDB entries)
    Uniprot P37727
  8. 2096883Domain d1ltxr1: 1ltx R:2-444,R:558-614 [84715]
    Other proteins in same PDB: d1ltxa1, d1ltxa2, d1ltxa3, d1ltxb_, d1ltxr2
    complexed with cl, far, zn

Details for d1ltxr1

PDB Entry: 1ltx (more details), 2.7 Å

PDB Description: structure of rab escort protein-1 in complex with rab geranylgeranyl transferase and isoprenoid
PDB Compounds: (R:) Rab Escort Protein 1

SCOPe Domain Sequences for d1ltxr1:

Sequence, based on SEQRES records: (download)

>d1ltxr1 c.3.1.3 (R:2-444,R:558-614) Rab escort protein 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
adnlpsdfdvivigtglpesiiaaacsrsgqrvlhvdsrsyyggnwasfsfsgllswlke
yqenndvvtensmwqeqileneeaiplsskdktiqhvevfcyasqdlhkdveeagalqkn
hasvtsaqsaeaaeaaetsclptaveplsmgsceipaeqsqcpgpesspevndaeatgkk
ensdakssteepsenvpkvqdntetpkknritysqiikegrrfnidlvskllysrgllid
lliksnvsryaefknitrilafregtveqvpcsradvfnskqltmvekrmlmkfltfcve
yeehpdeyrayegttfseylktqkltpnlqyfvlhsiamtsettsctvdglkatkkflqc
lgrygntpflfplygqgelpqcfcrmcavfggiyclrhsvqclvvdkesrkckavidqfg
qriiskhfiiedsylsentcsrvXsrdcyndlpsnvyvcsgpdsglgndnavkqaetlfq
qicpnedfcpappnpedivld

Sequence, based on observed residues (ATOM records): (download)

>d1ltxr1 c.3.1.3 (R:2-444,R:558-614) Rab escort protein 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
adnlpsdfdvivigtglpesiiaaacsrsgqrvlhvdsrsyyggnwasfsfsgllswlke
yqentensmwqeqileneeaiplsskdktiqhvevfcyasqdknritysqiikegrrfni
dlvskllysrgllidlliksnvsryaefknitrilafregtveqvpcsradvfnskqltm
vekrmlmkfltfcveyeehpdeyrayegttfseylktqkltpnlqyfvlhsiamtstsct
vdglkatkkflqclgrygntpflfplygqgelpqcfcrmcavfggiyclrhsvqclvvdk
esrkckavidqfgqriiskhfiiedsylsentcsrvXsrdcyndlpsnvyvcsgpdsglg
ndnavkqaetlfqqicpnedfpedivld

SCOPe Domain Coordinates for d1ltxr1:

Click to download the PDB-style file with coordinates for d1ltxr1.
(The format of our PDB-style files is described here.)

Timeline for d1ltxr1: