Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) N-terminal domain is beta/beta/alpha common fold |
Family d.16.1.6: GDI-like [54399] (2 proteins) Similar to FAD-linked reductases in both domains but does not bind FAD |
Protein Rab escort protein 1 [89845] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [89846] (3 PDB entries) Uniprot P37727 |
Domain d1ltxr2: 1ltx R:445-557 [84716] Other proteins in same PDB: d1ltxa1, d1ltxa2, d1ltxa3, d1ltxb_, d1ltxr1 complexed with cl, far, zn |
PDB Entry: 1ltx (more details), 2.7 Å
SCOPe Domain Sequences for d1ltxr2:
Sequence, based on SEQRES records: (download)
>d1ltxr2 d.16.1.6 (R:445-557) Rab escort protein 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]} qyrqisravlitdgsvlktdadqqvsiltvpaeepgsfavrvielcsstmtcmkgtylvh ltcmssktaredlervvqklftpyteieaeneqvekprllwalyfnmrdssdi
>d1ltxr2 d.16.1.6 (R:445-557) Rab escort protein 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]} qyrqisravlitdgsvlktdadqqvsiltvpaeepgsfavrvielcsstmtcmkgtylvh ltcmssktaredlervvqklftpyteieekprllwalyfnmrdssdi
Timeline for d1ltxr2:
View in 3D Domains from other chains: (mouse over for more information) d1ltxa1, d1ltxa2, d1ltxa3, d1ltxb_ |