PDB entry 1fyh

View 1fyh on RCSB PDB site
Description: 1:1 complex between an interferon gamma single-chain variant and its receptor
Class: immune system
Keywords: cytokine-receptor complex, fibronectin type-III, immune system
Deposited on 2000-09-29, released 2000-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interferon gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01579 (1-120)
      • initiating methionine (0)
      • engineered mutation (111)
      • linker (121-128)
    • Uniprot P01579 (129-End)
    Domains in SCOPe 2.07: d1fyha1, d1fyha2
  • Chain 'B':
    Compound: Interferon gamma receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNGR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fyhb1, d1fyhb2
  • Chain 'D':
    Compound: interferon gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01579 (1-120)
      • initiating methionine (0)
      • engineered mutation (111)
      • linker (121-128)
    • Uniprot P01579 (129-End)
    Domains in SCOPe 2.07: d1fyhd1, d1fyhd2
  • Chain 'E':
    Compound: Interferon gamma receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNGR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fyhe1, d1fyhe2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fyhA (A:)
    mqdpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfkn
    fkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaideliqvmae
    lganvsgefvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfk
    lfknfkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliq
    vmaelspaaktgkrkrsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fyhA (A:)
    mqdpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfkn
    fkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaideliqvmae
    lganvsgefvkeaenlkkyfndngtlflgilknwkeesdrkimqsqivsfyfklfknfkd
    dqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmaelsp
    aa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fyhB (B:)
    emgtadlgpssvptptnvtiesynmnpivyweyqimpqvpvftvevknygvknsewidac
    inishhycnisdhvgdpsnslwvrvkarvgqkesayakseefavcrdgkigppkldirke
    ekqimidifhpsvfvngdeqevdydpettcyirvynvyvrmngseiqykiltqkeddcde
    iqcqlaipvsslnsqycvsaegvlhvwgvttekskevcitifnssikgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fyhB (B:)
    vptptnvtiesynmnpivyweyqimpqvpvftvevknygvknsewidacinishhycnis
    dhvgdpsnslwvrvkarvgqkesayakseefavcrdgkigppkldirkeekqimidifhp
    svfvettcyirvynvyvrmngseiqykiltqkeddcdeiqcqlaipvsslnsqycvsaeg
    vlhvwgvttekskevcitifn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fyhD (D:)
    mqdpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfkn
    fkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaideliqvmae
    lganvsgefvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfk
    lfknfkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliq
    vmaelspaaktgkrkrsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fyhD (D:)
    mqdpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfkn
    fkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaideliqvmae
    lganvsgefvkeaenlkkyfngtlflgilknwkeesdrkimqsqivsfyfklfknfkddq
    siqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmaelspaa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1fyhE (E:)
    emgtadlgpssvptptnvtiesynmnpivyweyqimpqvpvftvevknygvknsewidac
    inishhycnisdhvgdpsnslwvrvkarvgqkesayakseefavcrdgkigppkldirke
    ekqimidifhpsvfvngdeqevdydpettcyirvynvyvrmngseiqykiltqkeddcde
    iqcqlaipvsslnsqycvsaegvlhvwgvttekskevcitifnssikgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fyhE (E:)
    vptptnvtiesynmnpivyweyqimpqvpvftvevknygvknsewidacinishhycnis
    dhvgdpsnslwvrvkarvgqkesayakseefavcrdgkigppkldirkeekqimidifhp
    svfvpettcyirvynvyvrmngseiqykiltqkeddcdeiqcqlaipvsslnsqycvsae
    gvlhvwgvttekskevcitif