Lineage for d1fyhe2 (1fyh E:110-222)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761991Protein Interferon-gamma receptor alpha chain [49293] (1 species)
  7. 2761992Species Human (Homo sapiens) [TaxId:9606] [49294] (3 PDB entries)
  8. 2761996Domain d1fyhe2: 1fyh E:110-222 [22058]
    Other proteins in same PDB: d1fyha1, d1fyha2, d1fyhd1, d1fyhd2
    complexed with cl

Details for d1fyhe2

PDB Entry: 1fyh (more details), 2.04 Å

PDB Description: 1:1 complex between an interferon gamma single-chain variant and its receptor
PDB Compounds: (E:) Interferon gamma receptor 1

SCOPe Domain Sequences for d1fyhe2:

Sequence, based on SEQRES records: (download)

>d1fyhe2 b.1.2.1 (E:110-222) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
igppkldirkeekqimidifhpsvfvngdeqevdydpettcyirvynvyvrmngseiqyk
iltqkeddcdeiqcqlaipvsslnsqycvsaegvlhvwgvttekskevcitif

Sequence, based on observed residues (ATOM records): (download)

>d1fyhe2 b.1.2.1 (E:110-222) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
igppkldirkeekqimidifhpsvfvpettcyirvynvyvrmngseiqykiltqkeddcd
eiqcqlaipvsslnsqycvsaegvlhvwgvttekskevcitif

SCOPe Domain Coordinates for d1fyhe2:

Click to download the PDB-style file with coordinates for d1fyhe2.
(The format of our PDB-style files is described here.)

Timeline for d1fyhe2: