SCOPe 2.08: Domain d1fyhd2: 1fyh D:201-324

Lineage for d1fyhd2 (1fyh D:201-324)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interferon-gamma [47318] (3 species)
   intertwined dimer

7. Species Human (Homo sapiens) [TaxId:9606] [47320] (5 PDB entries)

8. Domain d1fyhd2: 1fyh D:201-324 [16910]
   Other proteins in same PDB: d1fyhb1, d1fyhb2, d1fyhe1, d1fyhe2
   a single-chain variant
   complexed with cl

Details for d1fyhd2

PDB Entry: 1fyh, 2.04 Å

PDB Description: 1:1 complex between an interferon gamma single-chain variant and its receptor

PDB Compounds: (D:) interferon gamma

SCOPe Domain Sequences for d1fyhd2:

Sequence, based on SEQRES records:

>d1fyhd2 a.26.1.3 (D:201-324) Interferon-gamma {Human (Homo sapiens) [TaxId: 9606]}
sgefvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfknf
kddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmael
spaa

Sequence, based on observed residues (ATOM records):

>d1fyhd2 a.26.1.3 (D:201-324) Interferon-gamma {Human (Homo sapiens) [TaxId: 9606]}
sgefvkeaenlkkyfngtlflgilknwkeesdrkimqsqivsfyfklfknfkddqsiqks
vetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmaelspaa

Timeline for d1fyhd2:

• d1fyhd2 first appeared (with stable ids) in SCOP 1.55
  
• d1fyhd2 appears in SCOPe 2.07