SCOPe 2.08: Domain d1fyhe1: 1fyh E:12-109

Lineage for d1fyhe1 (1fyh E:12-109)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Interferon-gamma receptor alpha chain [49293] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49294] (3 PDB entries)

8. Domain d1fyhe1: 1fyh E:12-109 [22057]
   Other proteins in same PDB: d1fyha1, d1fyha2, d1fyhd1, d1fyhd2
   complexed with cl

Details for d1fyhe1

PDB Entry: 1fyh, 2.04 Å

PDB Description: 1:1 complex between an interferon gamma single-chain variant and its receptor

PDB Compounds: (E:) Interferon gamma receptor 1

SCOPe Domain Sequences for d1fyhe1:

Sequence; same for both SEQRES and ATOM records:

>d1fyhe1 b.1.2.1 (E:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
vptptnvtiesynmnpivyweyqimpqvpvftvevknygvknsewidacinishhycnis
dhvgdpsnslwvrvkarvgqkesayakseefavcrdgk

Timeline for d1fyhe1:

• d1fyhe1 first appeared (with stable ids) in SCOP 1.55
  
• d1fyhe1 appears in SCOPe 2.07