Lineage for d1fyhe1 (1fyh E:12-109)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2358952Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2358953Family b.1.2.1: Fibronectin type III [49266] (45 protein domains)
    Pfam PF00041
  6. 2359259Protein Interferon-gamma receptor alpha chain [49293] (1 species)
  7. 2359260Species Human (Homo sapiens) [TaxId:9606] [49294] (3 PDB entries)
  8. 2359263Domain d1fyhe1: 1fyh E:12-109 [22057]
    Other proteins in same PDB: d1fyha1, d1fyha2, d1fyhd1, d1fyhd2
    complexed with cl

Details for d1fyhe1

PDB Entry: 1fyh (more details), 2.04 Å

PDB Description: 1:1 complex between an interferon gamma single-chain variant and its receptor
PDB Compounds: (E:) Interferon gamma receptor 1

SCOPe Domain Sequences for d1fyhe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyhe1 b.1.2.1 (E:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
vptptnvtiesynmnpivyweyqimpqvpvftvevknygvknsewidacinishhycnis
dhvgdpsnslwvrvkarvgqkesayakseefavcrdgk

SCOPe Domain Coordinates for d1fyhe1:

Click to download the PDB-style file with coordinates for d1fyhe1.
(The format of our PDB-style files is described here.)

Timeline for d1fyhe1: