| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein Interferon-gamma receptor alpha chain [49293] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49294] (3 PDB entries) |
| Domain d1fyhb1: 1fyh B:12-109 [22055] Other proteins in same PDB: d1fyha1, d1fyha2, d1fyhd1, d1fyhd2 complexed with cl |
PDB Entry: 1fyh (more details), 2.04 Å
SCOPe Domain Sequences for d1fyhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
vptptnvtiesynmnpivyweyqimpqvpvftvevknygvknsewidacinishhycnis
dhvgdpsnslwvrvkarvgqkesayakseefavcrdgk
Timeline for d1fyhb1: