Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein CD1, alpha-3 domain [88615] (4 species) |
Species Human (Homo sapiens), CD1b [TaxId:9606] [88617] (3 PDB entries) |
Domain d1uqsa1: 1uqs A:184-283 [99791] Other proteins in same PDB: d1uqsa2, d1uqsb_ complexed with gmm |
PDB Entry: 1uqs (more details), 3.1 Å
SCOPe Domain Sequences for d1uqsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uqsa1 b.1.1.2 (A:184-283) CD1, alpha-3 domain {Human (Homo sapiens), CD1b [TaxId: 9606]} qvkpeawlssgpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnanwtw ylratldvadgeaaglscrvkhsslegqdiilywgpgsgg
Timeline for d1uqsa1: