Lineage for d1uqsa2 (1uqs A:3-183)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1020841Protein CD1, alpha-1 and alpha-2 domains [54456] (4 species)
    Class I MHC-related
  7. 1020848Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (3 PDB entries)
  8. 1020851Domain d1uqsa2: 1uqs A:3-183 [99792]
    Other proteins in same PDB: d1uqsa1, d1uqsb_
    complexed with gmm

Details for d1uqsa2

PDB Entry: 1uqs (more details), 3.1 Å

PDB Description: the crystal structure of human cd1b with a bound bacterial glycolipid
PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOPe Domain Sequences for d1uqsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uqsa2 d.19.1.1 (A:3-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]}
afqgptsfhviqtssftnstwaqtqgsgwlddlqihgwdsdsgtaiflkpwskgnfsdke
vaeleeifrvyifgfarevqdfagdfqmkypfeiqgiagcelhsggaivsflrgalggld
flsvknascvpspeggsraqkfcaliiqyqgimetvrillyetcpryllgvlnagkadlq
r

SCOPe Domain Coordinates for d1uqsa2:

Click to download the PDB-style file with coordinates for d1uqsa2.
(The format of our PDB-style files is described here.)

Timeline for d1uqsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uqsa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1uqsb_