Lineage for d1upn.1 (1upn D:,B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2086376Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2086604Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2086605Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2086625Protein Human enterovirus B coat proteins [88635] (4 species)
  7. 2086639Species Human echovirus 11 [TaxId:12078] [74890] (3 PDB entries)
  8. 2086643Domain d1upn.1: 1upn D:,B: [99761]
    Other proteins in same PDB: d1upne1, d1upne2

Details for d1upn.1

PDB Entry: 1upn (more details), 16 Å

PDB Description: complex of echovirus type 12 with domains 3 and 4 of its receptor decay accelerating factor (cd55) by cryo electron microscopy at 16 a
PDB Compounds: (B:) echovirus 11 coat protein vp2, (D:) echovirus 11 coat protein vp4

SCOPe Domain Sequences for d1upn.1:

Sequence, based on SEQRES records: (download)

>g1upn.1 b.121.4.1 (D:,B:) Human enterovirus B coat proteins {Human echovirus 11 [TaxId: 12078]}
gaqvstqktgahetglrasgnsiihytninyykdaasnsanrqdftqdpgkftepvkdim
vkslpalnXsdrvrsitlgnstittqesanvvvgygrwpeylrddeataedqptqpdvat
crfytlesvtwekdspgwwwkfpdalkdmglfgqnmyyhylgragytihvqcnaskfhqg
cllvvcvpeaemgcstvdgtvnehglsegetakkfsatgtngtntvqsivtnagmgvgvg
nltifphqwinlrtnncativmpyinnvpmdnmfrhhnftlmiipfvplnyssdfstyvp
itvtvapmcaeynglrlstal

Sequence, based on observed residues (ATOM records): (download)

>g1upn.1 b.121.4.1 (D:,B:) Human enterovirus B coat proteins {Human echovirus 11 [TaxId: 12078]}
gaqvstqktgahesiihytninyykdaasnsanrqdftqdpgkftepvkdimvkslpaln
Xsdrvrsitlgnstittqesanvvvgygrwpeylrddeataedqptqpdvatcrfytles
vtwekdspgwwwkfpdalkdmglfgqnmyyhylgragytihvqcnaskfhqgcllvvcvp
eaemgcstvdgtvnehglsegetakkfsatgtngtntvqsivtnagmgvgvgnltifphq
winlrtnncativmpyinnvpmdnmfrhhnftlmiipfvplnyssdfstyvpitvtvapm
caeynglrlstal

SCOPe Domain Coordinates for d1upn.1:

Click to download the PDB-style file with coordinates for d1upn.1.
(The format of our PDB-style files is described here.)

Timeline for d1upn.1: