Lineage for d1umia1 (1umi A:117-297)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046279Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2046280Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2046988Family b.18.1.21: F-box associated region, FBA [101585] (2 proteins)
    automatically mapped to Pfam PF04300
  6. 2046989Protein F-box only protein 2 [101586] (1 species)
  7. 2046990Species Mouse (Mus musculus) [TaxId:10090] [101587] (2 PDB entries)
  8. 2046992Domain d1umia1: 1umi A:117-297 [99606]
    Other proteins in same PDB: d1umia2

Details for d1umia1

PDB Entry: 1umi (more details), 2.4 Å

PDB Description: structural basis of sugar-recognizing ubiquitin ligase
PDB Compounds: (A:) F-box only protein 2

SCOPe Domain Sequences for d1umia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umia1 b.18.1.21 (A:117-297) F-box only protein 2 {Mouse (Mus musculus) [TaxId: 10090]}
fyflskrrrnllrnpageedlegwsdvehggdgwkveelpgdngveftqddsvkkyfass
fewcrkaqvidlqaegyweelldttqpaivvkdwysgrtdagslyeltvrllsenedvla
efatgqvavpedgswmeishtfidygpgvrfvrfehggqdsvywkgwfgarvtnssvwve
p

SCOPe Domain Coordinates for d1umia1:

Click to download the PDB-style file with coordinates for d1umia1.
(The format of our PDB-style files is described here.)

Timeline for d1umia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1umia2