Lineage for d1umia1 (1umi A:117-297)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
sandwich; 9 strands in 2 sheets; jelly-rollSuperfamily b.18.1: Galactose-binding domain-like [49785] (35 families) 
Family b.18.1.21: F-box associated region, FBA [101585] (2 proteins)
automatically mapped to Pfam PF04300
Protein F-box only protein 2 [101586] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [101587] (2 PDB entries) 
Domain d1umia1: 1umi A:117-297 [99606]
Other proteins in same PDB: d1umia2
Details for d1umia1
PDB Entry: 1umi (more details), 2.4 Å
PDB Description: structural basis of sugar-recognizing ubiquitin ligase
PDB Compounds: (A:) F-box only protein 2SCOPe Domain Sequences for d1umia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1umia1 b.18.1.21 (A:117-297) F-box only protein 2 {Mouse (Mus musculus) [TaxId: 10090]}
fyflskrrrnllrnpageedlegwsdvehggdgwkveelpgdngveftqddsvkkyfass
fewcrkaqvidlqaegyweelldttqpaivvkdwysgrtdagslyeltvrllsenedvla
efatgqvavpedgswmeishtfidygpgvrfvrfehggqdsvywkgwfgarvtnssvwve
p
SCOPe Domain Coordinates for d1umia1:
Click to download the PDB-style file with coordinates for d1umia1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1umia1:
- d1umia1 first appeared in SCOP 1.67, called d1umia_
- d1umia1 appears in SCOPe 2.06
- d1umia1 appears in the current release, SCOPe 2.08
View in 3D
