Lineage for d1so0d_ (1so0 D:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372004Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 372072Superfamily b.30.5: Galactose mutarotase-like [74650] (8 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 372247Family b.30.5.4: Aldose 1-epimerase (mutarotase) [74911] (2 proteins)
  6. 372252Protein Galactose mutarotase [74912] (2 species)
  7. 372253Species Human (Homo sapiens) [TaxId:9606] [101659] (2 PDB entries)
  8. 372259Domain d1so0d_: 1so0 D: [98935]
    complexed with gal

Details for d1so0d_

PDB Entry: 1so0 (more details), 2.3 Å

PDB Description: crystal structure of human galactose mutarotase complexed with galactose

SCOP Domain Sequences for d1so0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1so0d_ b.30.5.4 (D:) Galactose mutarotase {Human (Homo sapiens)}
masvtravfgelpsgggtvekfqlqsdllrvdiiswgctitalevkdrqgrasdvvlgfa
elegylqkqpyfgavigrvanriakgtfkvdgkeyhlainkepnslhggvrgfdkvlwtp
rvlsngvqfsrispdgeegypgelkvwvtytldggelivnyraqasqatpvnltnhsyfn
lagqaspnindhevtieadtylpvdetliptgevapvqgtafdlrkpvelgkhlqdfhln
gfdhnfclkgskekhfcarvhhaasgrvlevyttqpgvqfytgnfldgtlkgkngavypk
hsgfcletqnwpdavnqprfppvllrpgeeydhttwfkfsva

SCOP Domain Coordinates for d1so0d_:

Click to download the PDB-style file with coordinates for d1so0d_.
(The format of our PDB-style files is described here.)

Timeline for d1so0d_: