Lineage for d1so0d_ (1so0 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2781904Family b.30.5.4: Aldose 1-epimerase (mutarotase) [74911] (2 proteins)
    automatically mapped to Pfam PF01263
  6. 2781909Protein Galactose mutarotase [74912] (3 species)
  7. 2781912Species Human (Homo sapiens) [TaxId:9606] [101659] (2 PDB entries)
  8. 2781916Domain d1so0d_: 1so0 D: [98935]
    Other proteins in same PDB: d1so0a2, d1so0c2
    complexed with gal

Details for d1so0d_

PDB Entry: 1so0 (more details), 2.3 Å

PDB Description: crystal structure of human galactose mutarotase complexed with galactose
PDB Compounds: (D:) aldose 1-epimerase

SCOPe Domain Sequences for d1so0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1so0d_ b.30.5.4 (D:) Galactose mutarotase {Human (Homo sapiens) [TaxId: 9606]}
masvtravfgelpsgggtvekfqlqsdllrvdiiswgctitalevkdrqgrasdvvlgfa
elegylqkqpyfgavigrvanriakgtfkvdgkeyhlainkepnslhggvrgfdkvlwtp
rvlsngvqfsrispdgeegypgelkvwvtytldggelivnyraqasqatpvnltnhsyfn
lagqaspnindhevtieadtylpvdetliptgevapvqgtafdlrkpvelgkhlqdfhln
gfdhnfclkgskekhfcarvhhaasgrvlevyttqpgvqfytgnfldgtlkgkngavypk
hsgfcletqnwpdavnqprfppvllrpgeeydhttwfkfsva

SCOPe Domain Coordinates for d1so0d_:

Click to download the PDB-style file with coordinates for d1so0d_.
(The format of our PDB-style files is described here.)

Timeline for d1so0d_: