SCOPe 2.08: Domain d1smcb1: 1smc B:1-140

Lineage for d1smcb1 (1smc B:1-140)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)

7. Species Mycobacterium tuberculosis, rv2697c [TaxId:1773] [82213] (8 PDB entries)

8. Domain d1smcb1: 1smc B:1-140 [98921]
   Other proteins in same PDB: d1smcb2
   complexed with dut, no3, trs

Details for d1smcb1

PDB Entry: 1smc, 2.1 Å

PDB Description: Mycobacterium tuberculosis dUTPase complexed with dUTP in the absence of metal ion.

PDB Compounds: (B:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d1smcb1:

Sequence, based on SEQRES records:

>d1smcb1 b.85.4.1 (B:1-140) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c [TaxId: 1773]}
msttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvavavpfgmvgl
vhprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdriaqllvqrve
lvelvevssfdeaglastsr

Sequence, based on observed residues (ATOM records):

>d1smcb1 b.85.4.1 (B:1-140) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c [TaxId: 1773]}
msttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvavavpfgmvgl
vhprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdriaqllvqrve
lvelvevssfdeaglar

Timeline for d1smcb1:

• d1smcb1 first appeared in SCOP 1.67, called d1smcb_
  
• d1smcb1 appears in SCOPe 2.07