Lineage for d1s4eg1 (1s4e G:11-179)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194044Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1194045Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1194450Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (6 proteins)
  6. 1194457Protein Galactokinase [102762] (3 species)
  7. 1194465Species Pyrococcus furiosus [TaxId:2261] [102764] (1 PDB entry)
  8. 1194472Domain d1s4eg1: 1s4e G:11-179 [98489]
    Other proteins in same PDB: d1s4ea2, d1s4eb2, d1s4ec2, d1s4ed2, d1s4ee2, d1s4ef2, d1s4eg2, d1s4eh2, d1s4ei2
    complexed with adp, gla, mg

Details for d1s4eg1

PDB Entry: 1s4e (more details), 2.9 Å

PDB Description: pyrococcus furiosus galactokinase in complex with galactose, adp and magnesium
PDB Compounds: (G:) Galactokinase

SCOPe Domain Sequences for d1s4eg1:

Sequence, based on SEQRES records: (download)

>d1s4eg1 d.14.1.5 (G:11-179) Galactokinase {Pyrococcus furiosus [TaxId: 2261]}
rvnligehtdytygyvmpmaidlytiitaekydkvqlysehfneektftldnltkegswi
dyvkgvlwvliqegykigglkgkitgdlplgaglsssasfevgilevlnqlynlnidplk
kallakkaenefvgvpcgildqfavvfgkkdnvifldtqtlqyeyipfp

Sequence, based on observed residues (ATOM records): (download)

>d1s4eg1 d.14.1.5 (G:11-179) Galactokinase {Pyrococcus furiosus [TaxId: 2261]}
rvnligehtdytygyvmpmaidlywidygvlwvliqegydlpsssasevgiledplkkal
lakkaenefvcgildqfavvfgnvifldtqtlqyeyipfp

SCOPe Domain Coordinates for d1s4eg1:

Click to download the PDB-style file with coordinates for d1s4eg1.
(The format of our PDB-style files is described here.)

Timeline for d1s4eg1: