Class b: All beta proteins [48724] (176 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.3: Urease, beta-subunit [51278] (1 family) |
Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins) |
Protein Urease, beta-subunit [51280] (4 species) |
Species Bacillus pasteurii [TaxId:1474] [51282] (8 PDB entries) |
Domain d1s3tb_: 1s3t B: [98461] Other proteins in same PDB: d1s3ta_, d1s3tc1, d1s3tc2 complexed with bo3, ni, so4 |
PDB Entry: 1s3t (more details), 2.1 Å
SCOPe Domain Sequences for d1s3tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s3tb_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii [TaxId: 1474]} nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg ve
Timeline for d1s3tb_: