Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.8: Urease, gamma-subunit [54110] (1 superfamily) alpha(3)-beta(2); antiparallel hairpin |
Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) |
Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins) automatically mapped to Pfam PF00547 |
Protein Urease, gamma-subunit [54113] (4 species) |
Species Bacillus pasteurii [TaxId:1474] [54115] (9 PDB entries) |
Domain d1s3ta_: 1s3t A: [98460] Other proteins in same PDB: d1s3tb_, d1s3tc1, d1s3tc2 complexed with bo3, ni, so4 |
PDB Entry: 1s3t (more details), 2.1 Å
SCOPe Domain Sequences for d1s3ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s3ta_ d.8.1.1 (A:) Urease, gamma-subunit {Bacillus pasteurii [TaxId: 1474]} mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis
Timeline for d1s3ta_: