Lineage for d1r4ya_ (1r4y A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2923793Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2923794Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2924024Family d.1.1.3: Ribotoxin [81310] (2 proteins)
    the fungal cytotoxic ribonucleases with many insertions in the common fold
  6. 2924025Protein alpha-Sarcin [81309] (1 species)
  7. 2924026Species Fungus (Aspergillus giganteus) [TaxId:5060] [53953] (2 PDB entries)
  8. 2924028Domain d1r4ya_: 1r4y A: [97056]
    delta(7-22) mutant
    mutant

Details for d1r4ya_

PDB Entry: 1r4y (more details)

PDB Description: solution structure of the deletion mutant delta(7-22) of the cytotoxic ribonuclease alpha-sarcin
PDB Compounds: (A:) ribonuclease alpha-sarcin

SCOPe Domain Sequences for d1r4ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4ya_ d.1.1.3 (A:) alpha-Sarcin {Fungus (Aspergillus giganteus) [TaxId: 5060]}
avtwtcggllynqnkaesnshhaplsdgktgssyphwftngydgdgklpkgrtpikfgks
dcdrppkhskdgngktdhyllefptfpdghdykfdskkpkenpgparviytypnkvfcgi
iahtkenqgelklcsh

SCOPe Domain Coordinates for d1r4ya_:

Click to download the PDB-style file with coordinates for d1r4ya_.
(The format of our PDB-style files is described here.)

Timeline for d1r4ya_: